Loading...
Statistics
Advertisement

Perspolis Medical Center
www.iranhairtransplant.ir/

Iranhairtransplant.ir

Domain is redirected to: Iranhairtransplant.com
Advertisement
Conversion Technology Metas Server
Iranhairtransplant.ir is hosted in Germany . Iranhairtransplant.ir uses HTTPS protocol. Number of used technologies: 5. First technologies: CSS, Google Font API, Html, Number of used javascripts: 8. First javascripts: Jquery-1.10.1.min.js, Bootstrap.min.js, Supersized.3.2.7.js, Number of used analytics tools: 0. Its server type is: nginx.

Technologies in use by Iranhairtransplant.ir

Technology

Number of occurences: 5
  • CSS
  • Google Font API
  • Html
  • Html5
  • Php

Advertisement

Javascripts

Number of occurences: 8
  • jquery-1.10.1.min.js
  • bootstrap.min.js
  • supersized.3.2.7.js
  • jquery.countdown.js
  • config.js
  • scripts.js
  • jquery.easing.min.js
  • supersized.shutter.min.js

Server Type

  • nginx

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Iranhairtransplant.ir

SSL certificate

    • name: /C=US/ST=Someprovince/L=Sometown/O=none/OU=none/CN=localhost/emailAddress=webmaster@localhost
    • subject:
      • C: US
      • ST: Someprovince
      • L: Sometown
      • O: none
      • OU: none
      • CN: localhost
      • emailAddress: webmaster@localhost
    • hash: c4d44870
    • issuer:
      • C: US
      • ST: Someprovince
      • L: Sometown
      • O: none
      • OU: none
      • CN: localhost
      • emailAddress: webmaster@localhost
    • version: 0
    • serialNumber: 18085996334409068085
    • validFrom: 130122110715Z
    • validTo: 400608110715Z
    • validFrom_time_t: 1358852835
    • validTo_time_t: 2222766435
    • extensions:

    Meta - Iranhairtransplant.ir

    Number of occurences: 2
    • Name:
      Content: text/html;charset=utf-8
    • Name: viewport
      Content: width=device-width, initial-scale=1.0

    Server / Hosting

    • IP: 78.47.80.79
    • Latitude: 51.30
    • Longitude: 9.49
    • Country: Germany

    Rname

    • ns1.shivahost.net
    • ns2.shivahost.net
    • mail.iranhairtransplant.ir

    Target

    • hostmaster.iranhairtransplant.ir

    HTTP Header Response

    HTTP/1.1 301 Moved Permanently Server: nginx Date: Tue, 31 May 2016 01:09:08 GMT Content-Type: text/html Content-Length: 178 Location: http://www.iranhairtransplant.com/ X-Cache: MISS from s_hk1 X-Cache-Lookup: MISS from s_hk1:80 Via: 1.1 s_hk1 (squid/3.5.9) Connection: keep-alive HTTP/1.1 200 OK Server: nginx Date: Tue, 31 May 2016 01:09:09 GMT Content-Type: text/html Content-Length: 2058 Vary: Accept-Encoding X-Accel-Version: 0.01 Last-Modified: Wed, 14 Jan 2015 22:56:58 GMT ETag: "80a-50ca4a81a0280" Accept-Ranges: bytes Vary: Accept-Encoding,User-Agent X-Cache: MISS from s_hk1 X-Cache-Lookup: MISS from s_hk1:80 Via: 1.1 s_hk1 (squid/3.5.9) Connection: keep-alive

    DNS

    host: iranhairtransplant.ir
    1. class: IN
    2. ttl: 14400
    3. type: A
    4. ip: 78.47.80.79
    host: iranhairtransplant.ir
    1. class: IN
    2. ttl: 14400
    3. type: NS
    4. target: ns1.shivahost.net
    host: iranhairtransplant.ir
    1. class: IN
    2. ttl: 14400
    3. type: NS
    4. target: ns2.shivahost.net
    host: iranhairtransplant.ir
    1. class: IN
    2. ttl: 14400
    3. type: SOA
    4. mname: ns1.shivahost.net
    5. rname: hostmaster.iranhairtransplant.ir
    6. serial: 2015113001
    7. refresh: 14400
    8. retry: 3600
    9. expire: 1209600
    10. minimum-ttl: 86400
    host: iranhairtransplant.ir
    1. class: IN
    2. ttl: 14400
    3. type: MX
    4. pri: 10
    5. target: mail.iranhairtransplant.ir
    host: iranhairtransplant.ir
    1. class: IN
    2. ttl: 14400
    3. type: TXT
    4. txt: v=spf1 a mx ip4:78.47.80.79 -all
    5. entries: Array

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.ranhairtransplant.ir, www.irranhairtransplant.ir, www.rranhairtransplant.ir, www.ifranhairtransplant.ir, www.franhairtransplant.ir, www.ivranhairtransplant.ir, www.vranhairtransplant.ir, www.ikranhairtransplant.ir, www.kranhairtransplant.ir, www.i,ranhairtransplant.ir, www.,ranhairtransplant.ir, www.ibranhairtransplant.ir, www.branhairtransplant.ir, www.igranhairtransplant.ir, www.granhairtransplant.ir, www.itranhairtransplant.ir, www.tranhairtransplant.ir, www.iyranhairtransplant.ir, www.yranhairtransplant.ir, www.iuranhairtransplant.ir, www.uranhairtransplant.ir, www.ijranhairtransplant.ir, www.jranhairtransplant.ir, www.imranhairtransplant.ir, www.mranhairtransplant.ir, www.inranhairtransplant.ir, www.nranhairtransplant.ir, www.ianhairtransplant.ir, www.irianhairtransplant.ir, www.iianhairtransplant.ir, www.iroanhairtransplant.ir, www.ioanhairtransplant.ir, www.irlanhairtransplant.ir, www.ilanhairtransplant.ir, www.irlanhairtransplant.ir, www.ilanhairtransplant.ir, www.ir.anhairtransplant.ir, www.i.anhairtransplant.ir, www.irnhairtransplant.ir, www.iraonhairtransplant.ir, www.ironhairtransplant.ir, www.irapnhairtransplant.ir, www.irpnhairtransplant.ir, www.ira9nhairtransplant.ir, www.ir9nhairtransplant.ir, www.iranhairtransplant.ir, www.irnhairtransplant.ir, www.irainhairtransplant.ir, www.irinhairtransplant.ir, www.iraunhairtransplant.ir, www.irunhairtransplant.ir, www.irahairtransplant.ir, www.irannhairtransplant.ir, www.iranhairtransplant.ir, www.iranhhairtransplant.ir, www.irahhairtransplant.ir, www.iranjhairtransplant.ir, www.irajhairtransplant.ir, www.irankhairtransplant.ir, www.irakhairtransplant.ir, www.iranlhairtransplant.ir, www.iralhairtransplant.ir, www.iran hairtransplant.ir, www.ira hairtransplant.ir, www.iranairtransplant.ir, www.iranheairtransplant.ir, www.iraneairtransplant.ir, www.iranhdairtransplant.ir, www.irandairtransplant.ir, www.iranhcairtransplant.ir, www.irancairtransplant.ir, www.iranhuairtransplant.ir, www.iranuairtransplant.ir, www.iranhjairtransplant.ir, www.iranjairtransplant.ir, www.iranhairtransplant.ir, www.iranairtransplant.ir, www.iranhbairtransplant.ir, www.iranbairtransplant.ir, www.iranhgairtransplant.ir, www.irangairtransplant.ir, www.iranhirtransplant.ir, www.iranhaoirtransplant.ir, www.iranhoirtransplant.ir, www.iranhapirtransplant.ir, www.iranhpirtransplant.ir, www.iranha9irtransplant.ir, www.iranh9irtransplant.ir, www.iranhairtransplant.ir, www.iranhirtransplant.ir, www.iranhaiirtransplant.ir, www.iranhiirtransplant.ir, www.iranhauirtransplant.ir, www.iranhuirtransplant.ir, www.iranhartransplant.ir, www.iranhairrtransplant.ir, www.iranharrtransplant.ir, www.iranhaifrtransplant.ir, www.iranhafrtransplant.ir, www.iranhaivrtransplant.ir, www.iranhavrtransplant.ir, www.iranhaikrtransplant.ir, www.iranhakrtransplant.ir, www.iranhai,rtransplant.ir, www.iranha,rtransplant.ir, www.iranhaibrtransplant.ir, www.iranhabrtransplant.ir, www.iranhaigrtransplant.ir, www.iranhagrtransplant.ir, www.iranhaitrtransplant.ir, www.iranhatrtransplant.ir, www.iranhaiyrtransplant.ir, www.iranhayrtransplant.ir, www.iranhaiurtransplant.ir, www.iranhaurtransplant.ir, www.iranhaijrtransplant.ir, www.iranhajrtransplant.ir, www.iranhaimrtransplant.ir, www.iranhamrtransplant.ir, www.iranhainrtransplant.ir, www.iranhanrtransplant.ir, www.iranhaitransplant.ir, www.iranhairitransplant.ir, www.iranhaiitransplant.ir, www.iranhairotransplant.ir, www.iranhaiotransplant.ir, www.iranhairltransplant.ir, www.iranhailtransplant.ir, www.iranhairltransplant.ir, www.iranhailtransplant.ir, www.iranhair.transplant.ir, www.iranhai.transplant.ir, www.iranhairransplant.ir, www.iranhairtqransplant.ir, www.iranhairqransplant.ir, www.iranhairtaransplant.ir, www.iranhairaransplant.ir, www.iranhairt ransplant.ir, www.iranhair ransplant.ir, www.iranhairtwransplant.ir, www.iranhairwransplant.ir, www.iranhairteransplant.ir, www.iranhaireransplant.ir, www.iranhairtzransplant.ir, www.iranhairzransplant.ir, www.iranhairtxransplant.ir, www.iranhairxransplant.ir, www.iranhairtcransplant.ir, www.iranhaircransplant.ir, www.iranhairtansplant.ir, www.iranhairtriansplant.ir, www.iranhairtiansplant.ir, www.iranhairtroansplant.ir, www.iranhairtoansplant.ir, www.iranhairtrlansplant.ir, www.iranhairtlansplant.ir, www.iranhairtrlansplant.ir, www.iranhairtlansplant.ir, www.iranhairtr.ansplant.ir, www.iranhairt.ansplant.ir, www.iranhairtrnsplant.ir, www.iranhairtraonsplant.ir, www.iranhairtronsplant.ir, www.iranhairtrapnsplant.ir, www.iranhairtrpnsplant.ir, www.iranhairtra9nsplant.ir, www.iranhairtr9nsplant.ir, www.iranhairtransplant.ir, www.iranhairtrnsplant.ir, www.iranhairtrainsplant.ir, www.iranhairtrinsplant.ir, www.iranhairtraunsplant.ir, www.iranhairtrunsplant.ir,

    Other websites we recently analyzed

    1. opends.us
      Road Town (Virgin Islands, British) - 208.91.197.160
      Server software: Apache
      Technology: Html
      Number of meta tags: 2
    2. servico.info - Diese Website steht zum Verkauf! - Informationen zum Thema servico.
      Diese Website steht zum Verkauf! servico.info ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis hin zu speziellen Sachverhalten, finden Sie auf servico.info alles. Wir hoffen, dass Sie hier das Gesuchte finden!
      Cambridge (United States) - 72.52.4.90
      Server software: Apache
      Technology: Google Adsense, CSS, Html, Html5, Javascript, Php, SVG
      Number of Javascript: 3
      Number of meta tags: 4
    3. Roma Hotel
      RomaHotel.it - Guida turistica e Hotel di Roma. Oltre 1100 Hotel a Roma che puoi prenotare online. Servizio di assistenza e prenotazione Hotel a Roma: inoltre Mappa della Città di Roma, Cosa Vedere, Itinerari, Musei e Attrazioni Turistiche di Roma
      Arezzo (Italy) - 46.37.17.210
      Server software: Apache/2.2.15 (CentOS)
      Technology: Google Adsense, AJAX Libraries API, CSS, Html, Javascript, Php, Google +1 Button
      Number of Javascript: 6
      Number of meta tags: 4
    4. 35789.kim
      China - 124.16.31.156
      Server software: Tengine/1.4.2
      Technology: CloudFront, Google Adsense, Html, Javascript, Php
      Number of Javascript: 2
      Number of meta tags: 1
    5. calvarychapelmerrimackvalley.com at Directnic
      Cayman Islands - 74.117.222.18
      Server software: nginx/1.5.0
      Technology: Html, Javascript
      Number of Javascript: 1
    6. Massachusetts Society of Mayflower Descendants - HOME
      The Mission of the Massachusetts Society of Mayflower Descendants is to gather together to honor and perpetuate the memory of our Mayflower Ancestors and the ideals of American freedoms and democracy, which have evolved from The Mayflower Compact signed by the Pilgrim Fathers when they reached Cape Cod shores in November, 1620.
      Provo (United States) - 67.20.65.25
      Server software: nginx/1.10.1
      Technology: PayPal, CSS, Html, Javascript, Php, Joomla, Add This
      Number of Javascript: 15
      Number of meta tags: 5
    7. 55517.date - Diese Website steht zum Verkauf! - Informationen zum Thema 55517.
      Diese Website steht zum Verkauf! 55517.date ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis hin zu speziellen Sachverhalten, finden Sie auf 55517.date alles. Wir hoffen, dass Sie hier das Gesuchte finden!
      Cambridge (United States) - 72.52.4.90
      Server software: Apache/2.2.22 (Debian)
      Technology: Google Adsense, CSS, Html, Html5, Javascript, Php, SVG
      Number of Javascript: 4
      Number of meta tags: 5
    8. thebeautylotion.com
      Scottsdale (United States) - 50.63.202.48
      Server software: Microsoft-IIS/7.5
      Technology: Html, Html5, Iframe
    9. giftgiffy.com
      Scottsdale (United States) - 184.168.221.62
      Server software: Microsoft-IIS/7.5
      Technology: Html, Html5, Iframe
    10. seopill.com - Diese Website steht zum Verkauf! - Informationen zum Thema seopill.
      Diese
      Cambridge (United States) - 72.52.4.119
      Server software: Apache/2.2.22 (Debian)
      Technology: Google Adsense, Html, Html5, Javascript, Php, SVG
      Number of Javascript: 3
      Number of meta tags: 5

    Check Other Websites